PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN17979.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 517aa    MW: 57099.8 Da    PI: 9.307
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN17979.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-092062431954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  KHN17979.1 206 FEHflHPYPKDSDKVMLAKQTGLSRSQVSNWFINARVR 243
                 664459******************************88 PP

2BELL123.39.8e-4070141172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +rqelq+kk+kL+s+l+eV++rY+qy++q+q+v+ssFe++ag+g+ak+Yt+lAlk+iS++FrcLkdai+ qi
  KHN17979.1  70 QRQELQMKKSKLVSMLDEVEQRYRQYHHQMQIVVSSFEQAAGYGAAKSYTALALKTISKQFRCLKDAISAQI 141
                 69********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.5E-661139IPR006563POX domain
PfamPF075267.6E-492138IPR006563POX domain
PROSITE profilePS5007111.985184247IPR001356Homeobox domain
SMARTSM003891.2E-9187251IPR001356Homeobox domain
CDDcd000861.57E-11187248No hitNo description
SuperFamilySSF466893.68E-17188253IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-28190253IPR009057Homeodomain-like
PfamPF059202.0E-18204243IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MGSNYLKAAQ ELLDEAVNVG KGIYKEEKFA EKVKANREST NSGAAGGGDG SSGGGENSAG  60
KQVVELSTAQ RQELQMKKSK LVSMLDEVEQ RYRQYHHQMQ IVVSSFEQAA GYGAAKSYTA  120
LALKTISKQF RCLKDAISAQ IKATSKTLGE DDCLGVKVEG SRLRYVDHHL RQQRALQQLG  180
MIQPNAWRPQ RGLPERAVSI LRAWLFEHFL HPYPKDSDKV MLAKQTGLSR SQVSNWFINA  240
RVRLWKPMVE EMYLEEIKEH EQGNASENTK SKESSKELGS TANVAPESGA IKLDHLQSKQ  300
ESFKHQNTSP TEISTNSSMS PMGGSLQSPS GFHLAGSSDM QIRSPKKPRS SEIQNSPSSI  360
LSVGMEMKHN NNGDHANNRE ANNTKFGNER HHQKDGYPLM TSNANHGGGF GAFTMEDMGS  420
RFNVTTEQLA SRFHGNGVSL TLGLPHNENL SMPGTQQHGF LSQNIHLGRR LEMGTNGNEF  480
CAINTPPSSH SGTTYESIDI QNRKRFVAHQ LLPDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16193250158Homeobox protein Meis1
4xrs_B2e-16193250158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539486.10.0PREDICTED: BEL1-like homeodomain protein 1, partial
SwissprotQ9SJ561e-130BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A0B2QD960.0A0A0B2QD96_GLYSO; BEL1-like homeodomain protein 1
TrEMBLI1LTZ90.0I1LTZ9_SOYBN; Uncharacterized protein
STRINGGLYMA12G31480.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16273492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-121BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]